SCOPe 2.07: Domain d5yk3g_: 5yk3 G:

Lineage for d5yk3g_ (5yk3 G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein automated matches [190414] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)

8. Domain d5yk3g_: 5yk3 G: [362949]
   Other proteins in same PDB: d5yk3b2, d5yk3c2
   automated match to d1szva_

Details for d5yk3g_

PDB Entry: 5yk3, 3.01 Å

PDB Description: human ragulator complex

PDB Compounds: (G:) Ragulator complex protein LAMTOR2

SCOPe Domain Sequences for d5yk3g_:

Sequence; same for both SEQRES and ATOM records:

>d5yk3g_ d.110.7.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnq
afnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepltqv
aas

Timeline for d5yk3g_:

• d5yk3g_ is new in SCOPe 2.07-stable
  
• d5yk3g_ appears in the current release, SCOPe 2.08