Lineage for d6nkqb_ (6nkq B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2414280Protein automated matches [190163] (13 species)
    not a true protein
  7. 2414292Species Cow (Bos taurus) [TaxId:9913] [188392] (2 PDB entries)
  8. 2414295Domain d6nkqb_: 6nkq B: [362914]
    automated match to d4gnya_
    complexed with ca

Details for d6nkqb_

PDB Entry: 6nkq (more details), 2.3 Å

PDB Description: the structure of bovine beta-lactoglobulin in novel crystals grown at ph 3.8
PDB Compounds: (B:) beta-lactoglobulin

SCOPe Domain Sequences for d6nkqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nkqb_ b.60.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqch

SCOPe Domain Coordinates for d6nkqb_:

Click to download the PDB-style file with coordinates for d6nkqb_.
(The format of our PDB-style files is described here.)

Timeline for d6nkqb_: