Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein automated matches [190163] (13 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [188392] (2 PDB entries) |
Domain d6nkqb_: 6nkq B: [362914] automated match to d4gnya_ complexed with ca |
PDB Entry: 6nkq (more details), 2.3 Å
SCOPe Domain Sequences for d6nkqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nkqb_ b.60.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc lvrtpevddealekfdkalkalpmhirlsfnptqleeqch
Timeline for d6nkqb_: