SCOPe 2.07: Domain d6hvob2: 6hvo B:127-255

Lineage for d6hvob2 (6hvo B:127-255)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries)

8. Domain d6hvob2: 6hvo B:127-255 [362737]
   Other proteins in same PDB: d6hvoa3, d6hvoc3
   automated match to d1plqa2
   complexed with so4

Details for d6hvob2

PDB Entry: 6hvo, 2.1 Å

PDB Description: crystal structure of human pcna in complex with three peptides of p12 subunit of human polymerase delta

PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6hvob2:

Sequence, based on SEQRES records:

>d6hvob2 d.131.1.0 (B:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records):

>d6hvob2 d.131.1.0 (B:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
neeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlky
ylapki

Timeline for d6hvob2:

• d6hvob2 is new in SCOPe 2.07-stable
  
• d6hvob2 appears in the current release, SCOPe 2.08