Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries) |
Domain d6hvob2: 6hvo B:127-255 [362737] Other proteins in same PDB: d6hvoa3, d6hvoc3 automated match to d1plqa2 complexed with so4 |
PDB Entry: 6hvo (more details), 2.1 Å
SCOPe Domain Sequences for d6hvob2:
Sequence, based on SEQRES records: (download)
>d6hvob2 d.131.1.0 (B:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]} gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh lkyylapki
>d6hvob2 d.131.1.0 (B:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]} gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts neeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlky ylapki
Timeline for d6hvob2: