Lineage for d6hrdc2 (6hrd C:190-286)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334947Species Mycobacterium tuberculosis [TaxId:83332] [354674] (11 PDB entries)
  8. 2334966Domain d6hrdc2: 6hrd C:190-286 [362718]
    Other proteins in same PDB: d6hrda1, d6hrda3, d6hrdb1, d6hrdb3, d6hrdc1, d6hrdc3, d6hrdd1, d6hrdd3, d6hrde1, d6hrde3, d6hrdf1, d6hrdf3
    automated match to d2hdha1
    complexed with gol

Details for d6hrdc2

PDB Entry: 6hrd (more details), 2.11 Å

PDB Description: crystal structure of m. tuberculosis fadb2 (rv0468)
PDB Compounds: (C:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6hrdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hrdc2 a.100.1.0 (C:190-286) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gfvvnallvpyllsairmveagfatvedvdkavvaglshpmgplrlsdlvgldtlkliad
kmfeefkephygppplllrmveagqlgkksgrgfyty

SCOPe Domain Coordinates for d6hrdc2:

Click to download the PDB-style file with coordinates for d6hrdc2.
(The format of our PDB-style files is described here.)

Timeline for d6hrdc2: