Lineage for d5q0ba_ (5q0b A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621435Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2621436Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2621437Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2621684Protein automated matches [190281] (5 species)
    not a true protein
  7. 2621690Species Human (Homo sapiens) [TaxId:9606] [187709] (50 PDB entries)
  8. 2621823Domain d5q0ba_: 5q0b A: [362606]
    automated match to d1rdza_
    complexed with 96j

Details for d5q0ba_

PDB Entry: 5q0b (more details), 2.3 Å

PDB Description: human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, e.c.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-3-methyl-1,2-thiazol-5-yl)-3-(3-methylphenyl)sulfonylurea
PDB Compounds: (A:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d5q0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5q0ba_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagstnvtgd
qvkkldvlsndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidc
lvsvgtifgiyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldp
aigefilvdkdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsm
vadvhrtlvyggiflypankkspngklrllyecnpmayvmekaggmattgkeavldvipt
dihqrapvilgspddvleflkvyekhs

SCOPe Domain Coordinates for d5q0ba_:

Click to download the PDB-style file with coordinates for d5q0ba_.
(The format of our PDB-style files is described here.)

Timeline for d5q0ba_: