Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Legionella pneumophila [TaxId:446] [362417] (1 PDB entry) |
Domain d6nbmb2: 6nbm B:146-428 [362552] Other proteins in same PDB: d6nbma1, d6nbma3, d6nbmb1, d6nbmb3 automated match to d3qtpa2 complexed with mg, po4 |
PDB Entry: 6nbm (more details), 1.9 Å
SCOPe Domain Sequences for d6nbmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nbmb2 c.1.11.0 (B:146-428) automated matches {Legionella pneumophila [TaxId: 446]} mmtmpvpmmnilnggahadnnvdiqefmimpigapdfpvalqmgteifhvlksvlkkqgl ntavgdeggfapniqsnrqaldllseaiekagfrlgedivfaldvaaselfnegfyhmys enqkfdshqlieyyanlissypivsiedgldekdwsgwkqltthlgnkvqlvgddlfvtn pkilregiaqgianailikvnqigtlsetrqaiklaydngyrcvmshrsgetedtfiadl avasgcgqiktgslcrtdrtakynqllrinelaslpyagknil
Timeline for d6nbmb2: