SCOPe 2.07: Domain d6nbmb2: 6nbm B:146-428

Lineage for d6nbmb2 (6nbm B:146-428)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:446] [362417] (1 PDB entry)

8. Domain d6nbmb2: 6nbm B:146-428 [362552]
   Other proteins in same PDB: d6nbma1, d6nbma3, d6nbmb1, d6nbmb3
   automated match to d3qtpa2
   complexed with mg, po4

Details for d6nbmb2

PDB Entry: 6nbm, 1.9 Å

PDB Description: crystal structure of enolase from legionella pneumophila bound to phosphate and magnesium

PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d6nbmb2:

Sequence; same for both SEQRES and ATOM records:

>d6nbmb2 c.1.11.0 (B:146-428) automated matches {Legionella pneumophila [TaxId: 446]}
mmtmpvpmmnilnggahadnnvdiqefmimpigapdfpvalqmgteifhvlksvlkkqgl
ntavgdeggfapniqsnrqaldllseaiekagfrlgedivfaldvaaselfnegfyhmys
enqkfdshqlieyyanlissypivsiedgldekdwsgwkqltthlgnkvqlvgddlfvtn
pkilregiaqgianailikvnqigtlsetrqaiklaydngyrcvmshrsgetedtfiadl
avasgcgqiktgslcrtdrtakynqllrinelaslpyagknil

Timeline for d6nbmb2:

• d6nbmb2 is new in SCOPe 2.07-stable
  
• d6nbmb2 appears in the current release, SCOPe 2.08