SCOPe 2.07: Domain d5yy6a1: 5yy6 A:35-232

Lineage for d5yy6a1 (5yy6 A:35-232)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (15 PDB entries)
   Uniprot P93836 33-428 ! Uniprot P93836 63-459

8. Domain d5yy6a1: 5yy6 A:35-232 [362545]
   automated match to d5dhwa1
   complexed with 94l, co; mutant

Details for d5yy6a1

PDB Entry: 5yy6, 2.4 Å

PDB Description: crystal structure of arabidopsis thaliana hppd truncated mutant complexed with benquitrione

PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5yy6a1:

Sequence, based on SEQRES records:

>d5yy6a1 d.32.1.3 (A:35-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
isvangaipssppivlneavtiaevklygdvvlryvsykaedtekseflpgfervedass
fpldygirrldhavgnvp

Sequence, based on observed residues (ATOM records):

>d5yy6a1 d.32.1.3 (A:35-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
isvangaipssppivlneavtiaevklygdvvlryvsykaeflpgfervedassfpldyg
irrldhavgnvp

Timeline for d5yy6a1:

• d5yy6a1 is new in SCOPe 2.07-stable
  
• d5yy6a1 appears in the current release, SCOPe 2.08