Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6mj6c1: 6mj6 C:2-115 [362495] Other proteins in same PDB: d6mj6a1, d6mj6b_, d6mj6c2 automated match to d2pyfa1 complexed with bma, fuc, gol, jtm, na, nag |
PDB Entry: 6mj6 (more details), 2.45 Å
SCOPe Domain Sequences for d6mj6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mj6c1 b.1.1.0 (C:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd
Timeline for d6mj6c1: