Lineage for d6miya2 (6miy A:186-279)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 3062386Domain d6miya2: 6miy A:186-279 [362448]
    Other proteins in same PDB: d6miya1, d6miyb_, d6miyc2, d6miye1, d6miyf_, d6miyg2
    automated match to d1zt4c1
    complexed with cl, fuc, gol, jtv, na, nag

Details for d6miya2

PDB Entry: 6miy (more details), 2.75 Å

PDB Description: crystal structure of the mcd1d/xxa (jj239)/inktcr ternary complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6miya2:

Sequence, based on SEQRES records: (download)

>d6miya2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d6miya2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpsshrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylq
atldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d6miya2:

Click to download the PDB-style file with coordinates for d6miya2.
(The format of our PDB-style files is described here.)

Timeline for d6miya2:

  • d6miya2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17