SCOPe 2.07: Domain d6q6ub_: 6q6u B:

Lineage for d6q6ub_ (6q6u B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Chlamydomonas reinhardtii [TaxId:3055] [348632] (10 PDB entries)

8. Domain d6q6ub_: 6q6u B: [362437]
   automated match to d3kd0a_
   mutant

Details for d6q6ub_

PDB Entry: 6q6u, 1.81 Å

PDB Description: crystal structure of c39s mutant of thioredoxin h1 from chlamydomonas reinhardtii

PDB Compounds: (B:) Thioredoxin H-type

SCOPe Domain Sequences for d6q6ub_:

Sequence; same for both SEQRES and ATOM records:

>d6q6ub_ c.47.1.0 (B:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
gsvividskaawdaqlakgkeehkpivvdftatwcgpskmiaplfetlsndyagkviflk
vdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaa

Timeline for d6q6ub_:

• d6q6ub_ is new in SCOPe 2.07-stable
  
• d6q6ub_ appears in the current release, SCOPe 2.08