Lineage for d6mjja1 (6mjj A:7-185)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (65 PDB entries)
  8. 3062365Domain d6mjja1: 6mjj A:7-185 [362427]
    Other proteins in same PDB: d6mjja2, d6mjjb_, d6mjjc1, d6mjjc2, d6mjjd1, d6mjjd2
    automated match to d1zt4c2
    complexed with fuc, gol, ju4, na, nag

Details for d6mjja1

PDB Entry: 6mjj (more details), 1.93 Å

PDB Description: crystal structure of the mcd1d/xxm (jj290) /inktcr ternary complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6mjja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjja1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d6mjja1:

Click to download the PDB-style file with coordinates for d6mjja1.
(The format of our PDB-style files is described here.)

Timeline for d6mjja1:

  • d6mjja1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17