Lineage for d6njkb_ (6njk B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620668Species Sulfitobacter sp. [TaxId:52598] [362309] (1 PDB entry)
  8. 2620670Domain d6njkb_: 6njk B: [362412]
    automated match to d2wzxa_
    complexed with act

Details for d6njkb_

PDB Entry: 6njk (more details), 1.55 Å

PDB Description: crystal structure of beta-lactamase from sulfitobacter sp. ee-36
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6njkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6njkb_ e.3.1.0 (B:) automated matches {Sulfitobacter sp. [TaxId: 52598]}
satseqivdiadasfapvieqyripglvvgitwqgqhsfyatgvaarkgnvaatpdtife
lgsiskiftatlaalaedrgmldldapvsdsipqlegaafgairlvdlsthvtgglplqv
pgevgnvaelirwleswqppqpgtrsysnvsigllghitaqtmgmsfaqaaqdvlfpamg
lgstyvdvpddamdryafgydrktdapirvnpgvladeaygvkstardmlrlldlelgrg
ganpaltaalertrqgqaetayytqdmiweqypwpvdvarmeagngydfilspqpatrlt
pplppqrdvilnktgatngfggyvallpgqdlgivvlanrnypnearvrathalitdlla
tqd

SCOPe Domain Coordinates for d6njkb_:

Click to download the PDB-style file with coordinates for d6njkb_.
(The format of our PDB-style files is described here.)

Timeline for d6njkb_: