Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily) N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet |
Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) |
Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins) |
Protein automated matches [190281] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187709] (50 PDB entries) |
Domain d5q0ce_: 5q0c E: [362404] automated match to d1fsaa_ complexed with 96g, fdp |
PDB Entry: 5q0c (more details), 2.4 Å
SCOPe Domain Sequences for d5q0ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5q0ce_ e.7.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tdmltltryvmekgrqakgtgeltqllnsmltaikaissavrkaglahlygiagsvnvtg devkkldvlsnslvinmlqssystcvlvseenkdaiitakekrgkyvvcfdpldgssnid clasigtifaiyrktsedepsekdalqcgrnivaagyalygsatlvalstgqgvdlfmld palgefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkkkfpedgsapygaryvgs mvadvhrtlvyggiflypanqkspkgklrllyecnpvayiieqagglattgtqpvldvkp eaihqrvplilgspedvqeyltcvqknq
Timeline for d5q0ce_: