SCOP 1.61: Domain d1aqza_: 1aqz A:

Lineage for d1aqza_ (1aqz A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)

4. Superfamily d.1.1: Microbial ribonucleases [53933] (1 family)

5. Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)

6. Protein Ribotoxin [53951] (2 species)

7. Species Fungus (Aspergillus restrictus), restrictocin [53952] (4 PDB entries)

8. Domain d1aqza_: 1aqz A: [36238]

Details for d1aqza_

PDB Entry: 1aqz, 1.7 Å

PDB Description: crystal structure of a highly specific aspergillus ribotoxin, restrictocin

SCOP Domain Sequences for d1aqza_:

Sequence, based on SEQRES records:

>d1aqza_ d.1.1.1 (A:) Ribotoxin {Fungus (Aspergillus restrictus), restrictocin}
atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgpar
viytypnkvfcgivahqrgnqgdlrlcsh

Sequence, based on observed residues (ATOM records):

>d1aqza_ d.1.1.1 (A:) Ribotoxin {Fungus (Aspergillus restrictus), restrictocin}
atwtcinqqledkrllysqakaesnshhaplsdgktgssyphwftngydgngklikgrtp
ikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgparviytypn
kvfcgivahqrgnqgdlrlcsh

Timeline for d1aqza_:

• d1aqza_ first appeared (with stable ids) in SCOP 1.55
  
• d1aqza_ appears in SCOP 1.59
  
• d1aqza_ appears in SCOP 1.63
  
• d1aqza_ appears in the current release, SCOPe 2.08