Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d6miyb_: 6miy B: [362335] Other proteins in same PDB: d6miya1, d6miya2, d6miyc1, d6miyc2, d6miyd1, d6miyd2, d6miye1, d6miye2, d6miyg1, d6miyg2, d6miyh1, d6miyh2 automated match to d1p4lb_ complexed with cl, fuc, gol, jtv, na, nag |
PDB Entry: 6miy (more details), 2.75 Å
SCOPe Domain Sequences for d6miyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6miyb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d6miyb_: