Lineage for d6mjic2 (6mji C:116-204)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (854 PDB entries)
  8. 3062262Domain d6mjic2: 6mji C:116-204 [362324]
    Other proteins in same PDB: d6mjia1, d6mjia2, d6mjib_, d6mjic1, d6mjid1, d6mjid2
    automated match to d2pyfa2
    complexed with bma, fuc, gol, jtd, man, na, nag

Details for d6mjic2

PDB Entry: 6mji (more details), 2.3 Å

PDB Description: crystal structure of the mcd1d/xxs (jj304) /inktcr ternary complex
PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mjic2:

Sequence, based on SEQRES records: (download)

>d6mjic2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d6mjic2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6mjic2:

Click to download the PDB-style file with coordinates for d6mjic2.
(The format of our PDB-style files is described here.)

Timeline for d6mjic2:

  • d6mjic2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17