Lineage for d6miva1 (6miv A:7-185)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (65 PDB entries)
  8. 3062229Domain d6miva1: 6miv A:7-185 [362291]
    Other proteins in same PDB: d6miva2, d6mivb_, d6mivc1, d6mivc2, d6mivd1, d6mivd2
    automated match to d1zt4c2
    complexed with fuc, gol, ju1, na, nag

Details for d6miva1

PDB Entry: 6miv (more details), 2.05 Å

PDB Description: crystal structure of the mcd1d/xxq (jj300)/inktcr ternary complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6miva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6miva1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d6miva1:

Click to download the PDB-style file with coordinates for d6miva1.
(The format of our PDB-style files is described here.)

Timeline for d6miva1:

  • d6miva1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17