SCOPe 2.07: Domain d6mjjc1: 6mjj C:1-115

Lineage for d6mjjc1 (6mjj C:1-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6mjjc1: 6mjj C:1-115 [362253]
   Other proteins in same PDB: d6mjja1, d6mjjb_, d6mjjc2
   automated match to d2pyfa1
   complexed with fuc, gol, ju4, na, nag

Details for d6mjjc1

PDB Entry: 6mjj, 1.93 Å

PDB Description: crystal structure of the mcd1d/xxm (jj290) /inktcr ternary complex

PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mjjc1:

Sequence; same for both SEQRES and ATOM records:

>d6mjjc1 b.1.1.0 (C:1-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsng
rysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d6mjjc1:

• d6mjjc1 is new in SCOPe 2.07-stable
  
• d6mjjc1 appears in the current release, SCOPe 2.08