SCOPe 2.08: Domain d6miyh2: 6miy H:113-240

Lineage for d6miyh2 (6miy H:113-240)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6miyh2: 6miy H:113-240 [362241]
   Other proteins in same PDB: d6miya1, d6miyb_, d6miyc2, d6miye1, d6miyf_, d6miyg2
   automated match to d3q5ya2
   complexed with cl, gol, jtv, na

Details for d6miyh2

PDB Entry: 6miy, 2.75 Å

PDB Description: crystal structure of the mcd1d/xxa (jj239)/inktcr ternary complex

PDB Compounds: (H:) Beta-chain,T cell receptor chain,T cell receptor beta constant 2, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6miyh2:

Sequence; same for both SEQRES and ATOM records:

>d6miyh2 b.1.1.0 (H:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d6miyh2:

• d6miyh2 first appeared in SCOPe 2.07