Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6miyh2: 6miy H:113-240 [362241] Other proteins in same PDB: d6miya1, d6miyb_, d6miyc2, d6miye1, d6miyf_, d6miyg2 automated match to d3q5ya2 complexed with cl, gol, jtv, na |
PDB Entry: 6miy (more details), 2.75 Å
SCOPe Domain Sequences for d6miyh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6miyh2 b.1.1.0 (H:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d6miyh2: