Lineage for d6miyh1 (6miy H:2-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1129 PDB entries)
  8. 3062178Domain d6miyh1: 6miy H:2-112 [362240]
    Other proteins in same PDB: d6miya1, d6miyb_, d6miyc2, d6miye1, d6miyf_, d6miyg2
    automated match to d3q5ya1
    complexed with cl, fuc, gol, jtv, na, nag

Details for d6miyh1

PDB Entry: 6miy (more details), 2.75 Å

PDB Description: crystal structure of the mcd1d/xxa (jj239)/inktcr ternary complex
PDB Compounds: (H:) Beta-chain,T cell receptor chain,T cell receptor beta constant 2, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6miyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6miyh1 b.1.1.0 (H:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d6miyh1:

Click to download the PDB-style file with coordinates for d6miyh1.
(The format of our PDB-style files is described here.)

Timeline for d6miyh1:

  • d6miyh1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17