Lineage for d6mjid2 (6mji D:113-240)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367733Domain d6mjid2: 6mji D:113-240 [362239]
    Other proteins in same PDB: d6mjia1, d6mjib_, d6mjic2
    automated match to d3q5ya2
    complexed with bma, fuc, gol, jtd, man, na, nag

Details for d6mjid2

PDB Entry: 6mji (more details), 2.3 Å

PDB Description: crystal structure of the mcd1d/xxs (jj304) /inktcr ternary complex
PDB Compounds: (D:) Beta-chain,Tcell receptor chain,T cell receptor beta constant 2

SCOPe Domain Sequences for d6mjid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjid2 b.1.1.0 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d6mjid2:

Click to download the PDB-style file with coordinates for d6mjid2.
(The format of our PDB-style files is described here.)

Timeline for d6mjid2: