Lineage for d6mivd2 (6miv D:113-240)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1170 PDB entries)
  8. 3062150Domain d6mivd2: 6miv D:113-240 [362212]
    Other proteins in same PDB: d6miva1, d6mivb_, d6mivc2
    automated match to d3q5ya2
    complexed with fuc, gol, ju1, na, nag

Details for d6mivd2

PDB Entry: 6miv (more details), 2.05 Å

PDB Description: crystal structure of the mcd1d/xxq (jj300)/inktcr ternary complex
PDB Compounds: (D:) Beta-chain,Tcell receptor chain,T cell receptor beta constant 2

SCOPe Domain Sequences for d6mivd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mivd2 b.1.1.0 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d6mivd2:

Click to download the PDB-style file with coordinates for d6mivd2.
(The format of our PDB-style files is described here.)

Timeline for d6mivd2:

  • d6mivd2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17