Lineage for d6fgca3 (6fgc A:654-736)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427879Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2427928Family b.85.6.0: automated matches [259258] (1 protein)
    not a true family
  6. 2427929Protein automated matches [259259] (1 species)
    not a true protein
  7. 2427930Species Norway rat (Rattus norvegicus) [TaxId:10116] [259260] (9 PDB entries)
  8. 2427931Domain d6fgca3: 6fgc A:654-736 [362120]
    Other proteins in same PDB: d6fgca1, d6fgca2
    automated match to d2ftsa1
    complexed with act, adp, ca, cl, d95, mpd, mrd, po4

Details for d6fgca3

PDB Entry: 6fgc (more details), 1.5 Å

PDB Description: crystal structure of gephyrin e domain in complex with artesunate
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d6fgca3:

Sequence, based on SEQRES records: (download)

>d6fgca3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Sequence, based on observed residues (ATOM records): (download)

>d6fgca3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstglmsmrsangllmlppkteqy
velhkgevvdvmvigrl

SCOPe Domain Coordinates for d6fgca3:

Click to download the PDB-style file with coordinates for d6fgca3.
(The format of our PDB-style files is described here.)

Timeline for d6fgca3: