Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) automatically mapped to Pfam PF03454 |
Family b.85.6.0: automated matches [259258] (1 protein) not a true family |
Protein automated matches [259259] (1 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [259260] (9 PDB entries) |
Domain d6fgca3: 6fgc A:654-736 [362120] Other proteins in same PDB: d6fgca1, d6fgca2 automated match to d2ftsa1 complexed with act, adp, ca, cl, d95, mpd, mrd, po4 |
PDB Entry: 6fgc (more details), 1.5 Å
SCOPe Domain Sequences for d6fgca3:
Sequence, based on SEQRES records: (download)
>d6fgca3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp pkteqyvelhkgevvdvmvigrl
>d6fgca3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstglmsmrsangllmlppkteqy velhkgevvdvmvigrl
Timeline for d6fgca3: