Lineage for d1brga_ (1brg A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28524Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 28525Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 28526Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 28527Protein Barnase/Binase [53944] (2 species)
  7. 28528Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)
  8. 28595Domain d1brga_: 1brg A: [36190]

Details for d1brga_

PDB Entry: 1brg (more details), 2.2 Å

PDB Description: crystallographic analysis of phe->leu substitution in the hydrophobic core of barnase

SCOP Domain Sequences for d1brga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brga_ d.1.1.1 (A:) Barnase/Binase {Bacillus amyloliquefaciens}
vintldgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOP Domain Coordinates for d1brga_:

Click to download the PDB-style file with coordinates for d1brga_.
(The format of our PDB-style files is described here.)

Timeline for d1brga_: