Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily) 2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386 |
Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families) Pfam PF06236 |
Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins) |
Protein Tyrosinase cofactor MelC1 [254410] (1 species) |
Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries) |
Domain d5z0jb_: 5z0j B: [361897] Other proteins in same PDB: d5z0ja1, d5z0ja2 automated match to d2zmzb_ complexed with cu, no3, per |
PDB Entry: 5z0j (more details), 1.35 Å
SCOPe Domain Sequences for d5z0jb_:
Sequence, based on SEQRES records: (download)
>d5z0jb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]} aapesfdevykgrriqgrpagggahhhehgggyevfvdgvqlhvmrnadgswisvvshfd pvptpraaaraavdelqgapllpf
>d5z0jb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]} aapesfdevykgrriqgrpaehgggyevfvdgvqlhvmrnadgswisvvshfdpvptpra aaraavdelqgapllpf
Timeline for d5z0jb_: