SCOPe 2.07: Domain d6acfc1: 6acf C:1-134

Lineage for d6acfc1 (6acf C:1-134)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (38 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:272567] [361594] (1 PDB entry)

8. Domain d6acfc1: 6acf C:1-134 [361891]
   Other proteins in same PDB: d6acfa2, d6acfb2, d6acfc2, d6acfd2, d6acfe2, d6acff2, d6acfg2, d6acfh2
   automated match to d1leha2

Details for d6acfc1

PDB Entry: 6acf, 3 Å

PDB Description: structure of leucine dehydrogenase from geobacillus stearothermophilus by cryo-em

PDB Compounds: (C:) leucine dehydrogenase

SCOPe Domain Sequences for d6acfc1:

Sequence; same for both SEQRES and ATOM records:

>d6acfc1 c.58.1.0 (C:1-134) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
admdiiyqetdyvt

Timeline for d6acfc1:

• d6acfc1 is new in SCOPe 2.07-stable
  
• d6acfc1 appears in the current release, SCOPe 2.08