Lineage for d5z0sb_ (5z0s B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2587806Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2587807Species Human (Homo sapiens) [TaxId:9606] [56159] (47 PDB entries)
  8. 2587893Domain d5z0sb_: 5z0s B: [361873]
    automated match to d4v04b_
    complexed with 960

Details for d5z0sb_

PDB Entry: 5z0s (more details), 2.45 Å

PDB Description: crystal structure of fgfr1 kinase domain in complex with a novel inhibitor
PDB Compounds: (B:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d5z0sb_:

Sequence, based on SEQRES records: (download)

>d5z0sb_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalt

Sequence, based on observed residues (ATOM records): (download)

>d5z0sb_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekdlsd
lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlsskd
lvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardhhidyykkttng
rlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmd
kpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalt

SCOPe Domain Coordinates for d5z0sb_:

Click to download the PDB-style file with coordinates for d5z0sb_.
(The format of our PDB-style files is described here.)

Timeline for d5z0sb_: