Lineage for d6nddr_ (6ndd R:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500166Protein automated matches [190060] (2 species)
    not a true protein
  7. 2500169Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries)
  8. 2500231Domain d6nddr_: 6ndd R: [361858]
    Other proteins in same PDB: d6ndda_, d6nddb_, d6nddd_, d6ndde_, d6nddg_, d6nddh_, d6nddj_, d6nddk_, d6nddm_, d6nddn_, d6nddp_, d6nddq_
    automated match to d1aoxb_
    complexed with cl, mn, na, nh4, so4

Details for d6nddr_

PDB Entry: 6ndd (more details), 3.05 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain with manganese bound
PDB Compounds: (R:) Integrin alpha-2

SCOPe Domain Sequences for d6nddr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nddr_ c.62.1.1 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqif

SCOPe Domain Coordinates for d6nddr_:

Click to download the PDB-style file with coordinates for d6nddr_.
(The format of our PDB-style files is described here.)

Timeline for d6nddr_: