SCOP 1.61: Domain d1bnea_: 1bne A:

Lineage for d1bnea_ (1bne A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)

4. Superfamily d.1.1: Microbial ribonucleases [53933] (1 family)

5. Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)

6. Protein Barnase/Binase [53944] (2 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)

8. Domain d1bnea_: 1bne A: [36181]

Details for d1bnea_

PDB Entry: 1bne, 2.1 Å

PDB Description: barnase a43c/s80c disulfide mutant

SCOP Domain Sequences for d1bnea_:

Sequence; same for both SEQRES and ATOM records:

>d1bnea_ d.1.1.1 (A:) Barnase/Binase {Bacillus amyloliquefaciens}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnlcdvapgksiggdifsnregk
lpgksgrtwreadinytcgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1bnea_:

• d1bnea_ first appeared (with stable ids) in SCOP 1.55
  
• d1bnea_ appears in SCOP 1.59
  
• d1bnea_ appears in SCOP 1.63
  
• d1bnea_ appears in the current release, SCOPe 2.08