Lineage for d6ndao_ (6nda O:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892349Protein automated matches [190060] (2 species)
    not a true protein
  7. 2892352Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)
  8. 2892430Domain d6ndao_: 6nda O: [361789]
    Other proteins in same PDB: d6ndaa_, d6ndab_, d6ndad_, d6ndae_, d6ndag_, d6ndah_, d6ndaj_, d6ndak_, d6ndam_, d6ndan_, d6ndap_, d6ndaq_
    automated match to d1aoxb_
    complexed with cd, cl, na, nh4, so4

Details for d6ndao_

PDB Entry: 6nda (more details), 3.15 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain and cadmium
PDB Compounds: (O:) Integrin alpha-2

SCOPe Domain Sequences for d6ndao_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ndao_ c.62.1.1 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqif

SCOPe Domain Coordinates for d6ndao_:

Click to download the PDB-style file with coordinates for d6ndao_.
(The format of our PDB-style files is described here.)

Timeline for d6ndao_: