SCOP 1.63: Domain d1bsea_: 1bse A:

Lineage for d1bsea_ (1bse A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)

8. Domain d1bsea_: 1bse A: [36175]

Details for d1bsea_

PDB Entry: 1bse, 2 Å

PDB Description: crystal structural analysis of mutations in the hydrophobic cores of barnase

SCOP Domain Sequences for d1bsea_:

Sequence; same for both SEQRES and ATOM records:

>d1bsea_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrivyssdwliykttdhyqtftkir

Timeline for d1bsea_:

• d1bsea_ first appeared (with stable ids) in SCOP 1.55
  
• d1bsea_ appears in SCOP 1.61
  
• d1bsea_ appears in SCOP 1.65
  
• d1bsea_ appears in the current release, SCOPe 2.08