Lineage for d6hu7d_ (6hu7 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330003Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2330004Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) (S)
    automatically mapped to Pfam PF00906
  5. 2330005Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2330012Protein automated matches [191131] (3 species)
    not a true protein
  7. 2330039Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries)
  8. 2330074Domain d6hu7d_: 6hu7 D: [361738]
    automated match to d4bmga_

Details for d6hu7d_

PDB Entry: 6hu7 (more details), 2.8 Å

PDB Description: phosphorylated f97l hepatitis b core protein capsid
PDB Compounds: (D:) capsid protein

SCOPe Domain Sequences for d6hu7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hu7d_ a.62.1.1 (D:) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
sfgvwirtppayrppnapilstlpettvvrr

SCOPe Domain Coordinates for d6hu7d_:

Click to download the PDB-style file with coordinates for d6hu7d_.
(The format of our PDB-style files is described here.)

Timeline for d6hu7d_: