Lineage for d6ho4a1 (6ho4 A:25-94)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Ethr repressor [109651] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
Uniprot P96222 22-215
Domain d6ho4a1: 6ho4 A:25-94 [361736]
Other proteins in same PDB: d6ho4a2
automated match to d5nima1
protein/DNA complex; complexed with gfq, gol
Details for d6ho4a1
PDB Entry: 6ho4 (more details), 1.6 Å
PDB Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm44693
PDB Compounds: (A:) HTH-type transcriptional regulator EthRSCOPe Domain Sequences for d6ho4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ho4a1 a.4.1.9 (A:25-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
relailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqad
malqtlaenp
SCOPe Domain Coordinates for d6ho4a1:
Click to download the PDB-style file with coordinates for d6ho4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6ho4a1:
- d6ho4a1 is new in SCOPe 2.07-stable
- d6ho4a1 appears in the current release, SCOPe 2.08
View in 3D
