Lineage for d5zz9c_ (5zz9 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412995Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2413033Protein automated matches [226957] (2 species)
    not a true protein
  7. 2413055Species Mus musculus [TaxId:10090] [361564] (1 PDB entry)
  8. 2413058Domain d5zz9c_: 5zz9 C: [361566]
    automated match to d2p8va_

Details for d5zz9c_

PDB Entry: 5zz9 (more details), 2.3 Å

PDB Description: crystal structure of homer2 evh1/drebrin ppxxf complex
PDB Compounds: (C:) Homer protein homolog 2

SCOPe Domain Sequences for d5zz9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zz9c_ b.55.1.4 (C:) automated matches {Mus musculus [TaxId: 10090]}
eqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdgakviinstit
pnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaarlard

SCOPe Domain Coordinates for d5zz9c_:

Click to download the PDB-style file with coordinates for d5zz9c_.
(The format of our PDB-style files is described here.)

Timeline for d5zz9c_: