Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries) |
Domain d6h71c1: 6h71 C:6-121 [361419] Other proteins in same PDB: d6h71c2, d6h71d2 automated match to d1mqkh_ complexed with edo |
PDB Entry: 6h71 (more details), 2.31 Å
SCOPe Domain Sequences for d6h71c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h71c1 b.1.1.1 (C:6-121) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqaggslrlscaasgrmfsinsmgwyrqapgkerelvatiseagtttyadsvrg rftiardnakntvylqmnslnpedtavyycnayiqldstiwfraywgqgtqvtvss
Timeline for d6h71c1: