SCOPe 2.07: Domain d6h71c1: 6h71 C:6-121

Lineage for d6h71c1 (6h71 C:6-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)

8. Domain d6h71c1: 6h71 C:6-121 [361419]
   Other proteins in same PDB: d6h71c2, d6h71d2
   automated match to d1mqkh_
   complexed with edo

Details for d6h71c1

PDB Entry: 6h71, 2.31 Å

PDB Description: gi.1 human norovirus protruding domain in complex with nano-94

PDB Compounds: (C:) Nanobody (VHH) Nano-94

SCOPe Domain Sequences for d6h71c1:

Sequence; same for both SEQRES and ATOM records:

>d6h71c1 b.1.1.1 (C:6-121) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlscaasgrmfsinsmgwyrqapgkerelvatiseagtttyadsvrg
rftiardnakntvylqmnslnpedtavyycnayiqldstiwfraywgqgtqvtvss

Timeline for d6h71c1:

• d6h71c1 is new in SCOPe 2.07-stable
  
• d6h71c1 appears in the current release, SCOPe 2.08