Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries) |
Domain d6f7ca1: 6f7c A:1-245 [361412] Other proteins in same PDB: d6f7ca2, d6f7cb2, d6f7cc2, d6f7cd2, d6f7ce_, d6f7cf1, d6f7cf2 automated match to d5fnva1 complexed with acp, ca, cvt, gdp, gtp, mes, mg |
PDB Entry: 6f7c (more details), 2 Å
SCOPe Domain Sequences for d6f7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f7ca1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d6f7ca1: