Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins) |
Protein automated matches [196672] (8 species) not a true protein |
Species Paenibacillus barengoltzii [TaxId:1235795] [361209] (1 PDB entry) |
Domain d5yxtd_: 5yxt D: [361258] automated match to d2drsa_ |
PDB Entry: 5yxt (more details), 1.88 Å
SCOPe Domain Sequences for d5yxtd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yxtd_ a.102.1.2 (D:) automated matches {Paenibacillus barengoltzii [TaxId: 1235795]} mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc lylfallalsgnyriwmpr
Timeline for d5yxtd_: