Lineage for d5yxtd_ (5yxt D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335152Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2335247Protein automated matches [196672] (8 species)
    not a true protein
  7. 2335278Species Paenibacillus barengoltzii [TaxId:1235795] [361209] (1 PDB entry)
  8. 2335282Domain d5yxtd_: 5yxt D: [361258]
    automated match to d2drsa_

Details for d5yxtd_

PDB Entry: 5yxt (more details), 1.88 Å

PDB Description: crystal structure of reducing end xylose-releasing exo-oligoxylanase
PDB Compounds: (D:) Reducing end xylose-releasing exo-oligoxylanase

SCOPe Domain Sequences for d5yxtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxtd_ a.102.1.2 (D:) automated matches {Paenibacillus barengoltzii [TaxId: 1235795]}
mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
lylfallalsgnyriwmpr

SCOPe Domain Coordinates for d5yxtd_:

Click to download the PDB-style file with coordinates for d5yxtd_.
(The format of our PDB-style files is described here.)

Timeline for d5yxtd_: