Lineage for d5z19f3 (5z19 F:279-601)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441993Species [ruminococcus] gnavus [TaxId:33038] [361227] (3 PDB entries)
  8. 2442003Domain d5z19f3: 5z19 F:279-601 [361232]
    Other proteins in same PDB: d5z19a1, d5z19a2, d5z19b1, d5z19b2, d5z19c1, d5z19c2, d5z19d1, d5z19d2, d5z19e1, d5z19e2, d5z19f1, d5z19f2
    automated match to d5c70a3
    complexed with sj5

Details for d5z19f3

PDB Entry: 5z19 (more details), 2.5 Å

PDB Description: the crystal structure of ruminococcus gnavus beta-glucuronidase in complex with uronic isofagomine
PDB Compounds: (F:) beta-glucuronidase

SCOPe Domain Sequences for d5z19f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z19f3 c.1.8.0 (F:279-601) automated matches {[ruminococcus] gnavus [TaxId: 33038]}
vriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshypy
aeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiadte
emitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknskpe
lckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtdtm
aglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhkgv
ftrdrqpkaaavvfkdrwekkne

SCOPe Domain Coordinates for d5z19f3:

Click to download the PDB-style file with coordinates for d5z19f3.
(The format of our PDB-style files is described here.)

Timeline for d5z19f3: