Class a: All alpha proteins [46456] (289 folds) |
Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) automatically mapped to Pfam PF04253 |
Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins) |
Protein Glutamate carboxypeptidase II [140574] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140575] (34 PDB entries) Uniprot Q04609 594-750 |
Domain d6f5la3: 6f5l A:594-750 [361096] Other proteins in same PDB: d6f5la1, d6f5la2 automated match to d2c6ca1 complexed with bma, ca, cl, cqb, edo, man, nag, pge, zn |
PDB Entry: 6f5l (more details), 1.63 Å
SCOPe Domain Sequences for d6f5la3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f5la3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf dieskvdpskawgevkrqiyvaaftvqaaaetlseva
Timeline for d6f5la3: