SCOPe 2.07: Domain d6f5la3: 6f5l A:594-750

Lineage for d6f5la3 (6f5l A:594-750)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family)
   automatically mapped to Pfam PF04253

5. Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)

6. Protein Glutamate carboxypeptidase II [140574] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140575] (34 PDB entries)
   Uniprot Q04609 594-750

8. Domain d6f5la3: 6f5l A:594-750 [361096]
   Other proteins in same PDB: d6f5la1, d6f5la2
   automated match to d2c6ca1
   complexed with bma, ca, cl, cqb, edo, man, nag, pge, zn

Details for d6f5la3

PDB Entry: 6f5l, 1.63 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a inhibitor jhu2379

PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d6f5la3:

Sequence; same for both SEQRES and ATOM records:

>d6f5la3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Timeline for d6f5la3:

• d6f5la3 is new in SCOPe 2.07-stable
  
• d6f5la3 appears in the current release, SCOPe 2.08