Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Staphylococcus aureus [TaxId:273036] [340195] (4 PDB entries) |
Domain d6bulb1: 6bul B:2-182 [361059] Other proteins in same PDB: d6bula2, d6bulb2 automated match to d4kqxb1 complexed with e9g, e9j, mg, nap |
PDB Entry: 6bul (more details), 1.88 Å
SCOPe Domain Sequences for d6bulb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bulb1 c.2.1.0 (B:2-182) automated matches {Staphylococcus aureus [TaxId: 273036]} ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet t
Timeline for d6bulb1: