Lineage for d6bulb1 (6bul B:2-182)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456921Species Staphylococcus aureus [TaxId:273036] [340195] (4 PDB entries)
  8. 2456927Domain d6bulb1: 6bul B:2-182 [361059]
    Other proteins in same PDB: d6bula2, d6bulb2
    automated match to d4kqxb1
    complexed with e9g, e9j, mg, nap

Details for d6bulb1

PDB Entry: 6bul (more details), 1.88 Å

PDB Description: crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
PDB Compounds: (B:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6bulb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bulb1 c.2.1.0 (B:2-182) automated matches {Staphylococcus aureus [TaxId: 273036]}
ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
t

SCOPe Domain Coordinates for d6bulb1:

Click to download the PDB-style file with coordinates for d6bulb1.
(The format of our PDB-style files is described here.)

Timeline for d6bulb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bulb2