Lineage for d6mi6c_ (6mi6 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580397Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2580410Protein Histidine kinase CheA [55887] (2 species)
  7. 2580427Species Thermotoga maritima [TaxId:243274] [360831] (1 PDB entry)
  8. 2580430Domain d6mi6c_: 6mi6 C: [360861]
    automated match to d1i5da_
    complexed with adp, jsj, so4

Details for d6mi6c_

PDB Entry: 6mi6 (more details), 2.95 Å

PDB Description: structure of chea domain p4 in complex with an adp analog
PDB Compounds: (C:) chemotaxis protein chea

SCOPe Domain Sequences for d6mi6c_:

Sequence, based on SEQRES records: (download)

>d6mi6c_ d.122.1.3 (C:) Histidine kinase CheA {Thermotoga maritima [TaxId: 243274]}
irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtk
vtirlpl

Sequence, based on observed residues (ATOM records): (download)

>d6mi6c_ d.122.1.3 (C:) Histidine kinase CheA {Thermotoga maritima [TaxId: 243274]}
irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
hgiepkeeriakgkppigtlilsarhegnvvieveddgrgidkekiirkaiekglidesk
aatlsdqeilnflfvpgfstkvsevsgrgvgmdvvknvveslngsisiesekdkgtkvti
rlpl

SCOPe Domain Coordinates for d6mi6c_:

Click to download the PDB-style file with coordinates for d6mi6c_.
(The format of our PDB-style files is described here.)

Timeline for d6mi6c_: