Lineage for d6a97c1 (6a97 C:185-275)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (667 PDB entries)
  8. 3060707Domain d6a97c1: 6a97 C:185-275 [360769]
    Other proteins in same PDB: d6a97a1, d6a97b_, d6a97d_
    automated match to d4l4va2
    complexed with so4

Details for d6a97c1

PDB Entry: 6a97 (more details), 2.15 Å

PDB Description: crystal structure of mhc-like mill2
PDB Compounds: (C:) MHC I-like leukocyte 2 long form

SCOPe Domain Sequences for d6a97c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a97c1 b.1.1.0 (C:185-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gppmvtvtcrnypvgrvtltcrafnlytreatlvwlqdgkpvqqktfrsetilpsgdgty
qarvsirvlpgqepqfscnlrhgnhsimqta

SCOPe Domain Coordinates for d6a97c1:

Click to download the PDB-style file with coordinates for d6a97c1.
(The format of our PDB-style files is described here.)

Timeline for d6a97c1:

  • d6a97c1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06