Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d6a97d_: 6a97 D: [360761] Other proteins in same PDB: d6a97a1, d6a97a2, d6a97c1 automated match to d1kjvb_ complexed with so4 |
PDB Entry: 6a97 (more details), 2.15 Å
SCOPe Domain Sequences for d6a97d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a97d_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhasmaepktvywdrd
Timeline for d6a97d_:
View in 3D Domains from other chains: (mouse over for more information) d6a97a1, d6a97a2, d6a97b_, d6a97c1 |