Lineage for d5yvna2 (5yvn A:103-241)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326316Protein Class omega GST [81352] (1 species)
  7. 2326317Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries)
  8. 2326318Domain d5yvna2: 5yvn A:103-241 [360742]
    Other proteins in same PDB: d5yvna1
    automated match to d1eema1
    complexed with act, gsh, so4

Details for d5yvna2

PDB Entry: 5yvn (more details), 1.33 Å

PDB Description: human glutathione transferase omega1
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d5yvna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yvna2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

SCOPe Domain Coordinates for d5yvna2:

Click to download the PDB-style file with coordinates for d5yvna2.
(The format of our PDB-style files is described here.)

Timeline for d5yvna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yvna1