SCOPe 2.08: Domain d6n32h2: 6n32 H:116-228

Lineage for d6n32h2 (6n32 H:116-228)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d6n32h2: 6n32 H:116-228 [360726]
   Other proteins in same PDB: d6n32h1, d6n32k1, d6n32l1, d6n32l2, d6n32m1, d6n32m2
   automated match to d1op3h2
   complexed with so4

Details for d6n32h2

PDB Entry: 6n32, 2.2 Å

PDB Description: anti-hiv-1 fab 2g12 re-refinement

PDB Compounds: (H:) Fab 2G12 heavy chain

SCOPe Domain Sequences for d6n32h2:

Sequence, based on SEQRES records:

>d6n32h2 b.1.1.2 (H:116-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d6n32h2 b.1.1.2 (H:116-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d6n32h2:

• d6n32h2 first appeared in SCOPe 2.07