Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (25 species) not a true protein |
Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (3 PDB entries) |
Domain d5yt1b_: 5yt1 B: [360506] automated match to d3neda_ |
PDB Entry: 5yt1 (more details), 2 Å
SCOPe Domain Sequences for d5yt1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yt1b_ d.22.1.0 (B:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]} eelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatc fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki rgvnfpsngpvmqkktlgweantetlypadgglrghnpmalklvggghlicnlkttyrsk kpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdlpsklg
Timeline for d5yt1b_: