Lineage for d5yt1b_ (5yt1 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2548181Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (3 PDB entries)
  8. 2548190Domain d5yt1b_: 5yt1 B: [360506]
    automated match to d3neda_

Details for d5yt1b_

PDB Entry: 5yt1 (more details), 2 Å

PDB Description: crystal structrure of near infrared fluoresecent protein mneptune684
PDB Compounds: (B:) near infrared fluoresecent protein mNeptune684

SCOPe Domain Sequences for d5yt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yt1b_ d.22.1.0 (B:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
eelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatc
fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
rgvnfpsngpvmqkktlgweantetlypadgglrghnpmalklvggghlicnlkttyrsk
kpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdlpsklg

SCOPe Domain Coordinates for d5yt1b_:

Click to download the PDB-style file with coordinates for d5yt1b_.
(The format of our PDB-style files is described here.)

Timeline for d5yt1b_: