Lineage for d5ogqc_ (5ogq C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534811Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2534812Protein automated matches [190230] (23 species)
    not a true protein
  7. 2534835Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189710] (7 PDB entries)
  8. 2534845Domain d5ogqc_: 5ogq C: [360472]
    automated match to d3s3qa_
    complexed with 9u8, act

Details for d5ogqc_

PDB Entry: 5ogq (more details), 1.91 Å

PDB Description: structure of cathepsin b1 from schistosoma mansoni in complex with wrr391 inhibitor
PDB Compounds: (C:) Cathepsin B-like peptidase (C01 family)

SCOPe Domain Sequences for d5ogqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ogqc_ d.3.1.0 (C:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd
llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc
gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye
dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd
ecsiesevtagrin

SCOPe Domain Coordinates for d5ogqc_:

Click to download the PDB-style file with coordinates for d5ogqc_.
(The format of our PDB-style files is described here.)

Timeline for d5ogqc_: