Lineage for d6edra1 (6edr A:45-292)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466660Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2466704Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2466705Protein ADP ribosyl cyclase [56631] (4 species)
  7. 2466730Species Human (Homo sapiens) [TaxId:9606] [159490] (45 PDB entries)
    Uniprot P28907 45-291
  8. 2466816Domain d6edra1: 6edr A:45-292 [360402]
    Other proteins in same PDB: d6edra2, d6edrb2
    automated match to d1zvmc_
    complexed with zna

Details for d6edra1

PDB Entry: 6edr (more details), 2.4 Å

PDB Description: crystal structure of human cd38 in complex with 4'-thioribose nad+
PDB Compounds: (A:) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1

SCOPe Domain Sequences for d6edra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6edra1 c.23.14.3 (A:45-292) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
rwrqqwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefa
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvknpe

SCOPe Domain Coordinates for d6edra1:

Click to download the PDB-style file with coordinates for d6edra1.
(The format of our PDB-style files is described here.)

Timeline for d6edra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6edra2