Class b: All beta proteins [48724] (178 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein gamma-Crystallin [49697] (9 species) duplication consists of two domains of this fold |
Species Mouse (Mus musculus) [TaxId:10090] [255018] (5 PDB entries) |
Domain d6myhc2: 6myh C:91-177 [360347] automated match to d1zwma2 |
PDB Entry: 6myh (more details), 2.9 Å
SCOPe Domain Sequences for d6myhc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6myhc2 b.11.1.1 (C:91-177) gamma-Crystallin {Mouse (Mus musculus) [TaxId: 10090]} gqakiqvfekgdfngqmyettedcpsimeqfhlreihsckvvegtwifyelpnyrgrqyl ldkkeyrkpvdwgaaspaiqsfrrive
Timeline for d6myhc2: