SCOPe 2.07: Domain d6ewbk1: 6ewb K:0-109

Lineage for d6ewbk1 (6ewb K:0-109)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
Domain d6ewbk1: 6ewb K:0-109 [360274]
Other proteins in same PDB: d6ewbf2, d6ewbi2, d6ewbk2, d6ewbl2
automated match to d2fbjl1
complexed with edo

Details for d6ewbk1

PDB Entry: 6ewb (more details), 2.78 Å

PDB Description: crystal structure of gii.4 unsw 2012 p domain in complex with fab 10e9

PDB Compounds: (K:) Fab light chain

SCOPe Domain Sequences for d6ewbk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ewbk1 b.1.1.0 (K:0-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gqivltqsptimsaspgekvtmtcsasssvdymhwyqqksgtspkrwiydtyklasgvpa
rfsgsgsgtsysltinsmeaedaatyycqqwssnpltfgagtklelkrad

SCOPe Domain Coordinates for d6ewbk1:

Click to download the PDB-style file with coordinates for d6ewbk1.
(The format of our PDB-style files is described here.)

Timeline for d6ewbk1: